PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF012200030CFD_t1
Common NameTRAES_3BF012200030CFD_c1, TRAES_3BF012300030CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 420aa    MW: 45604.9 Da    PI: 6.6807
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF012200030CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.1e-19108153147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+WT+eEdell ++v ++G + W+tI+++++ gR +kqc++rw ++
  TRAES3BF012200030CFD_t1 108 RGPWTEEEDELLRRLVDEHGEHKWATISEHLP-GRIGKQCRERWTNH 153
                              89******************************.***********997 PP

2Myb_DNA-binding51.22.8e-16164203445
                              S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              WT+ +d  l+da+k +G++ W++Iar+++ gR+++ +k++w+
  TRAES3BF012200030CFD_t1 164 WTEADDIVLIDAHKIHGNR-WSSIARCLP-GRSENAVKNHWN 203
                              *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.042105158IPR017930Myb domain
SMARTSM007171.3E-18107156IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-30107202IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-23108156IPR009057Homeodomain-like
PfamPF002492.2E-18108153IPR001005SANT/Myb domain
CDDcd001675.13E-17110154No hitNo description
Gene3DG3DSA:1.10.10.603.0E-17157206IPR009057Homeodomain-like
PROSITE profilePS5129416.455159210IPR017930Myb domain
SMARTSM007177.8E-13160208IPR001005SANT/Myb domain
CDDcd001671.35E-12164203No hitNo description
PfamPF002494.3E-13164203IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MASLGDMLLN QELAAVAAMS ADAHGRFGRY TLSPAHGFSH FQQAGSAPTG FPDTGLLISG  60
FGMPPSTFIM PEGTHAAAGY GAEVVPVEIP VVRRQRPAAR NDGATPFRGP WTEEEDELLR  120
RLVDEHGEHK WATISEHLPG RIGKQCRERW TNHVRPGIKK EHIWTEADDI VLIDAHKIHG  180
NRWSSIARCL PGRSENAVKN HWNATRRSLK SKRRFKKKTS QQAAPGQFTL LEEYIRDKMM  240
ADENLAPSSP LAGVAYDGQV VPGAAAMLAV STPPGMGQYL HPANAAGSSS QAGMMNLSVP  300
LPDLNAYSGE MLERYYYPTY SNNLLPYGPE PAFPQMFSAQ GRMHAACTNL NLFPLPQHPG  360
GGYYGSETGR RSAGGGYYGS ETGRSSAGGS SDQDEDVAQM ASREFQTSED EATLDLTGFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-391082057103B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A077RXG20.0A0A077RXG2_WHEAT; Uncharacterized protein
STRINGMLOC_14401.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.16e-34myb domain protein 118
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]